PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043131m
Common NameCISIN_1g043131mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 593aa    MW: 64776 Da    PI: 4.843
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043131mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.68.1e-1372265871374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        lv++L++cAeav++++l+la+a++++++ la +++ +m ++a++f+eALa+r+++    ly    p++  +++ se l +   f+e++P+lk
  orange1.1g043131m 226 LVHALMACAEAVQQNNLTLAEAFVKQIRFLAVSQAGAMGKVATHFAEALARRIYG----LY----PQSPIDHSFSELLEM--QFYETCPYLK 307
                        689****************************************************....44....444433334444444..5********* PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        f+h+taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++Ae+++v+fe++ +va+
  orange1.1g043131m 308 FAHFTANQAILEAFDGKRRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAADNTDQLQQVGWKLAQLAESIHVEFEYRGFVAN 399
                        ******************************************************************************************** PP

               GRAS 185 rledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        +l+dl+ ++L++kp   +++aVn+v++lh+ll++++++++    vL++vk+++P++++v+eqea+hn++ Fl+rf+e+l+yys++fdsle +
  orange1.1g043131m 400 SLADLDASMLEIKPseVDSVAVNSVFELHKLLAQPGAIDK----VLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEGS 487
                        **************55568*************99999999....************************************************ PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdr 365
                        + + ++++++ E+  +g++i+nvvacega+r+erhetl++Wr r+++aGF p++++++a+kqa++ll+ ++ +dgy+vee++g+l+lgW +r
  orange1.1g043131m 488 VNSPENHKAMTEAY-MGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHIGSNAYKQASMLLALFAgGDGYKVEENNGCLTLGWYTR 578
                        97777766666665.***************************************************************************** PP

               GRAS 366 pLvsvSaWr 374
                        pL+++SaW+
  orange1.1g043131m 579 PLIATSAWK 587
                        ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.7E-3339105IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.5E-2839112No hitNo description
PROSITE profilePS5098565.401200566IPR005202Transcription factor GRAS
PfamPF035142.8E-134226587IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MKREHSQLDP PPPPPSCLAG PSGKGKMWEE EQTDGGGMDE LLAVLGYNVR SSDMVEVAQK  60
IEQLEEAMGA FQADGINHLA TDTVHYDPSN LCTWLESMLT EFNPTMPAGL GLDPVPAPSV  120
FDDSSFVAPA ESSTITSLDF SHQRVLEEPS TSDYDLKAIP GKAMYGANNS QNSSNNYLSL  180
SSASASSLSS STTTRENKRL KTSEFYPPES TRPIVLADSQ ENGIRLVHAL MACAEAVQQN  240
NLTLAEAFVK QIRFLAVSQA GAMGKVATHF AEALARRIYG LYPQSPIDHS FSELLEMQFY  300
ETCPYLKFAH FTANQAILEA FDGKRRVHVI DFSMNQGMQW PALMQALALR PGGPPAFRLT  360
GIGPPAADNT DQLQQVGWKL AQLAESIHVE FEYRGFVANS LADLDASMLE IKPSEVDSVA  420
VNSVFELHKL LAQPGAIDKV LSVVKNIKPD IFTVAEQEAN HNGPVFLDRF TESLHYYSTM  480
FDSLEGSVNS PENHKAMTEA YMGNQICNVV ACEGADRVER HETLAQWRTR FSSAGFIPAH  540
IGSNAYKQAS MLLALFAGGD GYKVEENNGC LTLGWYTRPL IATSAWKLAA KR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-542265874375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006469195.10.0PREDICTED: DELLA protein GAIP-B
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A067FB950.0A0A067FB95_CITSI; Uncharacterized protein
STRINGPOPTR_0010s12080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein